PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003979.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 341aa    MW: 34804 Da    PI: 8.994
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003979.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.33e-3785143361
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 e  lkcprCdstntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Do003979.1  85 EPGLKCPRCDSTNTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 143
                 56789************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3968142IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.78988142IPR003851Zinc finger, Dof-type
PfamPF027017.0E-3288142IPR003851Zinc finger, Dof-type
PROSITE patternPS01361090126IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MIFPPAFLDS SSWNDNQQQQ QQQAHHQVGA GGGGGDGNHD LLQPSIMGGA LPEGAGGGGG  60
AGQVGPAKPM SMAERARLAR IPLPEPGLKC PRCDSTNTKF CYFNNYSLSQ PRHFCRACRR  120
YWTRGGALRN VPVGGGYRRH AKRAKPKAAA AAGSAATSGG TASAATAALA PAGSTSSACA  180
TTNVPAHPGH AMLGGNLSML PPLLRLADFD AMSLGSSFSG MGKPSLDAAG AYSVGGGSGP  240
GGLEQWRVQQ MQSFPFLHAM DQGLLGPPLA MTMAPGMFQL GLDSGDGRGG GAGGEDGSGE  300
LHVMQAKREG YQARGMYGDH HLAAAGYASY TNNAATGNHL L
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960512.11e-150PREDICTED: dof zinc finger protein DOF3.6-like isoform X2
TrEMBLK3Z7M71e-148K3Z7M7_SETIT; Uncharacterized protein
STRINGSi022547m1e-148(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-44OBF-binding protein 3